Anti ALDOC pAb (ATL-HPA003282 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003282-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA003282 antibody. Corresponding ALDOC RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli fibrillar center & cytosol.
  • Western blot analysis in human cerebral cortex tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aldolase C, fructose-bisphosphate
Gene Name: ALDOC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017390: 99%, ENSRNOG00000011452: 100%
Entrez Gene ID: 230
Uniprot ID: P09972
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI
Gene Sequence MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI
Gene ID - Mouse ENSMUSG00000017390
Gene ID - Rat ENSRNOG00000011452
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALDOC pAb (ATL-HPA003282 w/enhanced validation)
Datasheet Anti ALDOC pAb (ATL-HPA003282 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDOC pAb (ATL-HPA003282 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALDOC pAb (ATL-HPA003282 w/enhanced validation)
Datasheet Anti ALDOC pAb (ATL-HPA003282 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDOC pAb (ATL-HPA003282 w/enhanced validation)



Citations for Anti ALDOC pAb (ATL-HPA003282 w/enhanced validation) – 1 Found
Fack, Fred; Espedal, Heidi; Keunen, Olivier; Golebiewska, Anna; Obad, Nina; Harter, Patrick N; Mittelbronn, Michel; Bähr, Oliver; Weyerbrock, Astrid; Stuhr, Linda; Miletic, Hrvoje; Sakariassen, Per Ø; Stieber, Daniel; Rygh, Cecilie B; Lund-Johansen, Morten; Zheng, Liang; Gottlieb, Eyal; Niclou, Simone P; Bjerkvig, Rolf. Bevacizumab treatment induces metabolic adaptation toward anaerobic metabolism in glioblastomas. Acta Neuropathologica. 2015;129(1):115-31.  PubMed