Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002198-100

Protein Description: aldolase B, fructose-bisphosphate
Gene Name: ALDOB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028307: 97%, ENSRNOG00000006807: 96%
Entrez Gene ID: 229
Uniprot ID: P05062
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA
• Gene Sequence: KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA
• Gene ID - Mouse: ENSMUSG00000028307
• Gene ID - Rat: ENSRNOG00000006807
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) – 2 Found

Kampf, Caroline; Mardinoglu, Adil; Fagerberg, Linn; Hallström, Björn M; Edlund, Karolina; Lundberg, Emma; Pontén, Fredrik; Nielsen, Jens; Uhlen, Mathias. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2014;28(7):2901-14. 

Merkulova, Maria; Hurtado-Lorenzo, Andrés; Hosokawa, Hiroyuki; Zhuang, Zhenjie; Brown, Dennis; Ausiello, Dennis A; Marshansky, Vladimir. Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution. American Journal Of Physiology. Cell Physiology. 2011;300(6):C1442-55.