Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002198-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: aldolase B, fructose-bisphosphate
Gene Name: ALDOB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028307: 97%, ENSRNOG00000006807: 96%
Entrez Gene ID: 229
Uniprot ID: P05062
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA
Gene Sequence KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA
Gene ID - Mouse ENSMUSG00000028307
Gene ID - Rat ENSRNOG00000006807
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation)
Datasheet Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation)
Datasheet Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation)
Citations for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) – 2 Found
Kampf, Caroline; Mardinoglu, Adil; Fagerberg, Linn; Hallström, Björn M; Edlund, Karolina; Lundberg, Emma; Pontén, Fredrik; Nielsen, Jens; Uhlen, Mathias. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2014;28(7):2901-14.  PubMed
Merkulova, Maria; Hurtado-Lorenzo, Andrés; Hosokawa, Hiroyuki; Zhuang, Zhenjie; Brown, Dennis; Ausiello, Dennis A; Marshansky, Vladimir. Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution. American Journal Of Physiology. Cell Physiology. 2011;300(6):C1442-55.  PubMed