Anti ALDOA pAb (ATL-HPA004177)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004177-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ALDOA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030695: 100%, ENSRNOG00000052802: 100%
Entrez Gene ID: 226
Uniprot ID: P04075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL |
| Gene Sequence | IVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL |
| Gene ID - Mouse | ENSMUSG00000030695 |
| Gene ID - Rat | ENSRNOG00000052802 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDOA pAb (ATL-HPA004177) | |
| Datasheet | Anti ALDOA pAb (ATL-HPA004177) Datasheet (External Link) |
| Vendor Page | Anti ALDOA pAb (ATL-HPA004177) at Atlas Antibodies |
| Documents & Links for Anti ALDOA pAb (ATL-HPA004177) | |
| Datasheet | Anti ALDOA pAb (ATL-HPA004177) Datasheet (External Link) |
| Vendor Page | Anti ALDOA pAb (ATL-HPA004177) |
| Citations for Anti ALDOA pAb (ATL-HPA004177) – 7 Found |
| Na, Ning; Li, Heng; Xu, Chengfang; Miao, Bin; Hong, Liangqing; Huang, Zhengyu; Jiang, Qiu. High expression of Aldolase A predicts poor survival in patients with clear-cell renal cell carcinoma. Therapeutics And Clinical Risk Management. 13( 28280347):279-285. PubMed |
| Morson, Sarah; Yang, Yifei; Price, David J; Pratt, Thomas. Expression of Genes in the 16p11.2 Locus during Development of the Human Fetal Cerebral Cortex. Cerebral Cortex (New York, N.y. : 1991). 2021;31(9):4038-4052. PubMed |
| Du, Sha; Guan, Zhuzhu; Hao, Lihong; Song, Yang; Wang, Lan; Gong, Linlin; Liu, Lu; Qi, Xiaoyu; Hou, Zhaoyuan; Shao, Shujuan. Fructose-bisphosphate aldolase a is a potential metastasis-associated marker of lung squamous cell carcinoma and promotes lung cell tumorigenesis and migration. Plos One. 9(1):e85804. PubMed |
| Kjellin, Hanna; Johansson, Henrik; Höög, Anders; Lehtiö, Janne; Jakobsson, Per-Johan; Kjellman, Magnus. Differentially expressed proteins in malignant and benign adrenocortical tumors. Plos One. 9(2):e87951. PubMed |
| Morisaki, Tamami; Yashiro, Masakazu; Kakehashi, Anna; Inagaki, Azusa; Kinoshita, Haruhito; Fukuoka, Tatsunari; Kasashima, Hiroaki; Masuda, Go; Sakurai, Katsunobu; Kubo, Naoshi; Muguruma, Kazuya; Ohira, Masaichi; Wanibuchi, Hideki; Hirakawa, Kosei. Comparative proteomics analysis of gastric cancer stem cells. Plos One. 9(11):e110736. PubMed |
| Monrad, Ida; Madsen, Charlotte; Lauridsen, Kristina Lystlund; Honoré, Bent; Plesner, Trine Lindhardt; Hamilton-Dutoit, Stephen; d'Amore, Francesco; Ludvigsen, Maja. Glycolytic biomarkers predict transformation in patients with follicular lymphoma. Plos One. 15(5):e0233449. PubMed |
| Moghimi, Seyedehmahsa; Viktorova, Ekaterina G; Gabaglio, Samuel; Zimina, Anna; Budnik, Bogdan; Wynn, Bridge G; Sztul, Elizabeth; Belov, George A. A Proximity biotinylation assay with a host protein bait reveals multiple factors modulating enterovirus replication. Plos Pathogens. 2022;18(10):e1010906. PubMed |