Anti ALDOA pAb (ATL-HPA004177)

Atlas Antibodies

Catalog No.: ATL-HPA004177-25

Protein Description: aldolase A, fructose-bisphosphate
Gene Name: ALDOA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030695: 100%, ENSRNOG00000052802: 100%
Entrez Gene ID: 226
Uniprot ID: P04075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL
• Gene Sequence: IVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL
• Gene ID - Mouse: ENSMUSG00000030695
• Gene ID - Rat: ENSRNOG00000052802
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDOA pAb (ATL-HPA004177) – 7 Found

Na, Ning; Li, Heng; Xu, Chengfang; Miao, Bin; Hong, Liangqing; Huang, Zhengyu; Jiang, Qiu. High expression of Aldolase A predicts poor survival in patients with clear-cell renal cell carcinoma. Therapeutics And Clinical Risk Management. 13( 28280347):279-285. 

Morson, Sarah; Yang, Yifei; Price, David J; Pratt, Thomas. Expression of Genes in the 16p11.2 Locus during Development of the Human Fetal Cerebral Cortex. Cerebral Cortex (New York, N.y. : 1991). 2021;31(9):4038-4052. 

Du, Sha; Guan, Zhuzhu; Hao, Lihong; Song, Yang; Wang, Lan; Gong, Linlin; Liu, Lu; Qi, Xiaoyu; Hou, Zhaoyuan; Shao, Shujuan. Fructose-bisphosphate aldolase a is a potential metastasis-associated marker of lung squamous cell carcinoma and promotes lung cell tumorigenesis and migration. Plos One. 9(1):e85804. 

Kjellin, Hanna; Johansson, Henrik; Höög, Anders; Lehtiö, Janne; Jakobsson, Per-Johan; Kjellman, Magnus. Differentially expressed proteins in malignant and benign adrenocortical tumors. Plos One. 9(2):e87951. 

Morisaki, Tamami; Yashiro, Masakazu; Kakehashi, Anna; Inagaki, Azusa; Kinoshita, Haruhito; Fukuoka, Tatsunari; Kasashima, Hiroaki; Masuda, Go; Sakurai, Katsunobu; Kubo, Naoshi; Muguruma, Kazuya; Ohira, Masaichi; Wanibuchi, Hideki; Hirakawa, Kosei. Comparative proteomics analysis of gastric cancer stem cells. Plos One. 9(11):e110736. 

Monrad, Ida; Madsen, Charlotte; Lauridsen, Kristina Lystlund; Honoré, Bent; Plesner, Trine Lindhardt; Hamilton-Dutoit, Stephen; d'Amore, Francesco; Ludvigsen, Maja. Glycolytic biomarkers predict transformation in patients with follicular lymphoma. Plos One. 15(5):e0233449. 

Moghimi, Seyedehmahsa; Viktorova, Ekaterina G; Gabaglio, Samuel; Zimina, Anna; Budnik, Bogdan; Wynn, Bridge G; Sztul, Elizabeth; Belov, George A. A Proximity biotinylation assay with a host protein bait reveals multiple factors modulating enterovirus replication. Plos Pathogens. 2022;18(10):e1010906.