Anti ALDH9A1 pAb (ATL-HPA010873)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010873-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALDH9A1
Alternative Gene Name: ALDH4, ALDH7, ALDH9, E3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026687: 88%, ENSRNOG00000004027: 86%
Entrez Gene ID: 223
Uniprot ID: P49189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD |
| Gene Sequence | DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD |
| Gene ID - Mouse | ENSMUSG00000026687 |
| Gene ID - Rat | ENSRNOG00000004027 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH9A1 pAb (ATL-HPA010873) | |
| Datasheet | Anti ALDH9A1 pAb (ATL-HPA010873) Datasheet (External Link) |
| Vendor Page | Anti ALDH9A1 pAb (ATL-HPA010873) at Atlas Antibodies |
| Documents & Links for Anti ALDH9A1 pAb (ATL-HPA010873) | |
| Datasheet | Anti ALDH9A1 pAb (ATL-HPA010873) Datasheet (External Link) |
| Vendor Page | Anti ALDH9A1 pAb (ATL-HPA010873) |
| Citations for Anti ALDH9A1 pAb (ATL-HPA010873) – 2 Found |
| Scicchitano, Marshall S; Dalmas, Deidre A; Boyce, Rogely W; Thomas, Heath C; Frazier, Kendall S. Protein extraction of formalin-fixed, paraffin-embedded tissue enables robust proteomic profiles by mass spectrometry. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2009;57(9):849-60. PubMed |
| Matsunaga, Atsuko; Harita, Yutaka; Shibagaki, Yoshio; Shimizu, Nobutaka; Shibuya, Kazuhiko; Ono, Hiroshi; Kato, Hitoshi; Sekine, Takashi; Sakamoto, Naoko; Igarashi, Takashi; Hattori, Seisuke. Identification of 4-Trimethylaminobutyraldehyde Dehydrogenase (TMABA-DH) as a Candidate Serum Autoantibody Target for Kawasaki Disease. Plos One. 10(5):e0128189. PubMed |