Anti ALDH9A1 pAb (ATL-HPA010873)

Atlas Antibodies

SKU:
ATL-HPA010873-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Western blot analysis in human cell line TD47D.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 9 family, member A1
Gene Name: ALDH9A1
Alternative Gene Name: ALDH4, ALDH7, ALDH9, E3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026687: 88%, ENSRNOG00000004027: 86%
Entrez Gene ID: 223
Uniprot ID: P49189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD
Gene Sequence DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD
Gene ID - Mouse ENSMUSG00000026687
Gene ID - Rat ENSRNOG00000004027
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALDH9A1 pAb (ATL-HPA010873)
Datasheet Anti ALDH9A1 pAb (ATL-HPA010873) Datasheet (External Link)
Vendor Page Anti ALDH9A1 pAb (ATL-HPA010873) at Atlas Antibodies

Documents & Links for Anti ALDH9A1 pAb (ATL-HPA010873)
Datasheet Anti ALDH9A1 pAb (ATL-HPA010873) Datasheet (External Link)
Vendor Page Anti ALDH9A1 pAb (ATL-HPA010873)



Citations for Anti ALDH9A1 pAb (ATL-HPA010873) – 2 Found
Scicchitano, Marshall S; Dalmas, Deidre A; Boyce, Rogely W; Thomas, Heath C; Frazier, Kendall S. Protein extraction of formalin-fixed, paraffin-embedded tissue enables robust proteomic profiles by mass spectrometry. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2009;57(9):849-60.  PubMed
Matsunaga, Atsuko; Harita, Yutaka; Shibagaki, Yoshio; Shimizu, Nobutaka; Shibuya, Kazuhiko; Ono, Hiroshi; Kato, Hitoshi; Sekine, Takashi; Sakamoto, Naoko; Igarashi, Takashi; Hattori, Seisuke. Identification of 4-Trimethylaminobutyraldehyde Dehydrogenase (TMABA-DH) as a Candidate Serum Autoantibody Target for Kawasaki Disease. Plos One. 10(5):e0128189.  PubMed