Anti ALDH6A1 pAb (ATL-HPA029074 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029074-25
  • Immunohistochemistry analysis in human liver and tonsil tissues using Anti-ALDH6A1 antibody. Corresponding ALDH6A1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
  • Western blot analysis using Anti-ALDH6A1 antibody HPA029074 (A) shows similar pattern to independent antibody HPA029073 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 6 family, member A1
Gene Name: ALDH6A1
Alternative Gene Name: MMSDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021238: 96%, ENSRNOG00000011419: 97%
Entrez Gene ID: 4329
Uniprot ID: Q02252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNKAGEYIFERGSRHGKRVQ
Gene Sequence GNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNKAGEYIFERGSRHGKRVQ
Gene ID - Mouse ENSMUSG00000021238
Gene ID - Rat ENSRNOG00000011419
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ALDH6A1 pAb (ATL-HPA029074 w/enhanced validation)
Datasheet Anti ALDH6A1 pAb (ATL-HPA029074 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH6A1 pAb (ATL-HPA029074 w/enhanced validation)



Citations for Anti ALDH6A1 pAb (ATL-HPA029074 w/enhanced validation) – 1 Found
Bisen, Shivantika; Kakhniashvili, David; Johnson, Daniel L; Bukiya, Anna N. Proteomic Analysis of Baboon Cerebral Artery Reveals Potential Pathways of Damage by Prenatal Alcohol Exposure. Molecular & Cellular Proteomics : Mcp. 2019;18(2):294-307.  PubMed