Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029716-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 5 family, member A1
Gene Name: ALDH5A1
Alternative Gene Name: SSADH, SSDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035936: 94%, ENSRNOG00000023538: 93%
Entrez Gene ID: 7915
Uniprot ID: P51649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQV
Gene Sequence ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQV
Gene ID - Mouse ENSMUSG00000035936
Gene ID - Rat ENSRNOG00000023538
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation)
Datasheet Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation)
Datasheet Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation)
Citations for Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) – 1 Found
Ippolito, Joseph E; Piwnica-Worms, David. A fluorescence-coupled assay for gamma aminobutyric acid (GABA) reveals metabolic stress-induced modulation of GABA content in neuroendocrine cancer. Plos One. 9(2):e88667.  PubMed