Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029716-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALDH5A1
Alternative Gene Name: SSADH, SSDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035936: 94%, ENSRNOG00000023538: 93%
Entrez Gene ID: 7915
Uniprot ID: P51649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQV |
| Gene Sequence | ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQV |
| Gene ID - Mouse | ENSMUSG00000035936 |
| Gene ID - Rat | ENSRNOG00000023538 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) | |
| Datasheet | Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) | |
| Datasheet | Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) |
| Citations for Anti ALDH5A1 pAb (ATL-HPA029716 w/enhanced validation) – 1 Found |
| Ippolito, Joseph E; Piwnica-Worms, David. A fluorescence-coupled assay for gamma aminobutyric acid (GABA) reveals metabolic stress-induced modulation of GABA content in neuroendocrine cancer. Plos One. 9(2):e88667. PubMed |