Anti ALDH5A1 pAb (ATL-HPA029715 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029715-25

• 
• 

Protein Description: aldehyde dehydrogenase 5 family, member A1
Gene Name: ALDH5A1
Alternative Gene Name: SSADH, SSDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035936: 87%, ENSRNOG00000023538: 87%
Entrez Gene ID: 7915
Uniprot ID: P51649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM
• Gene Sequence: RKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM
• Gene ID - Mouse: ENSMUSG00000035936
• Gene ID - Rat: ENSRNOG00000023538
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.