Anti ALDH4A1 pAb (ATL-HPA072759)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072759-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ALDH4A1
Alternative Gene Name: ALDH4, P5CDh
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028737: 92%, ENSRNOG00000061876: 89%
Entrez Gene ID: 8659
Uniprot ID: P30038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKE |
Gene Sequence | LSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKE |
Gene ID - Mouse | ENSMUSG00000028737 |
Gene ID - Rat | ENSRNOG00000061876 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALDH4A1 pAb (ATL-HPA072759) | |
Datasheet | Anti ALDH4A1 pAb (ATL-HPA072759) Datasheet (External Link) |
Vendor Page | Anti ALDH4A1 pAb (ATL-HPA072759) at Atlas Antibodies |
Documents & Links for Anti ALDH4A1 pAb (ATL-HPA072759) | |
Datasheet | Anti ALDH4A1 pAb (ATL-HPA072759) Datasheet (External Link) |
Vendor Page | Anti ALDH4A1 pAb (ATL-HPA072759) |