Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045132-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 3 family, member B2
Gene Name: ALDH3B2
Alternative Gene Name: ALDH8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037263: 62%, ENSRNOG00000017872: 68%
Entrez Gene ID: 222
Uniprot ID: P48448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Gene Sequence SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Gene ID - Mouse ENSMUSG00000037263
Gene ID - Rat ENSRNOG00000017872
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation)
Datasheet Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation)
Datasheet Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation)
Citations for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) – 1 Found
Han, Guanghui; Zhen, Weizhe; Dai, Yuan; Yu, Hongni; Li, Dongyue; Ma, Tao. Dihuang-Yinzi Alleviates Cognition Deficits via Targeting Energy-Related Metabolism in an Alzheimer Mouse Model as Demonstrated by Integration of Metabolomics and Network Pharmacology. Frontiers In Aging Neuroscience. 14( 35431901):873929.  PubMed