Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045132-25

Protein Description: aldehyde dehydrogenase 3 family, member B2
Gene Name: ALDH3B2
Alternative Gene Name: ALDH8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037263: 62%, ENSRNOG00000017872: 68%
Entrez Gene ID: 222
Uniprot ID: P48448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
• Gene Sequence: SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
• Gene ID - Mouse: ENSMUSG00000037263
• Gene ID - Rat: ENSRNOG00000017872
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) – 1 Found

Han, Guanghui; Zhen, Weizhe; Dai, Yuan; Yu, Hongni; Li, Dongyue; Ma, Tao. Dihuang-Yinzi Alleviates Cognition Deficits via Targeting Energy-Related Metabolism in an Alzheimer Mouse Model as Demonstrated by Integration of Metabolomics and Network Pharmacology. Frontiers In Aging Neuroscience. 14( 35431901):873929.