Anti ALDH3B1 pAb (ATL-HPA038525)

Atlas Antibodies

Catalog No.: ATL-HPA038525-25

Protein Description: aldehyde dehydrogenase 3 family, member B1
Gene Name: ALDH3B1
Alternative Gene Name: ALDH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024885: 82%, ENSRNOG00000017512: 84%
Entrez Gene ID: 221
Uniprot ID: P43353
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPF
• Gene Sequence: AAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPF
• Gene ID - Mouse: ENSMUSG00000024885
• Gene ID - Rat: ENSRNOG00000017512
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.