Anti ALDH3B1 pAb (ATL-HPA038525)

Atlas Antibodies

Catalog No.:
ATL-HPA038525-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 3 family, member B1
Gene Name: ALDH3B1
Alternative Gene Name: ALDH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024885: 82%, ENSRNOG00000017512: 84%
Entrez Gene ID: 221
Uniprot ID: P43353
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPF
Gene Sequence AAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPF
Gene ID - Mouse ENSMUSG00000024885
Gene ID - Rat ENSRNOG00000017512
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH3B1 pAb (ATL-HPA038525)
Datasheet Anti ALDH3B1 pAb (ATL-HPA038525) Datasheet (External Link)
Vendor Page Anti ALDH3B1 pAb (ATL-HPA038525) at Atlas Antibodies

Documents & Links for Anti ALDH3B1 pAb (ATL-HPA038525)
Datasheet Anti ALDH3B1 pAb (ATL-HPA038525) Datasheet (External Link)
Vendor Page Anti ALDH3B1 pAb (ATL-HPA038525)