Anti ALDH3A2 pAb (ATL-HPA014769)

Atlas Antibodies

SKU: ATL-HPA014769-25

• 

Protein Description: aldehyde dehydrogenase 3 family, member A2
Gene Name: ALDH3A2
Alternative Gene Name: ALDH10, FALDH , SLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010025: 84%, ENSRNOG00000002342: 85%
Entrez Gene ID: 224
Uniprot ID: P51648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE
• Gene Sequence: SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE
• Gene ID - Mouse: ENSMUSG00000010025
• Gene ID - Rat: ENSRNOG00000002342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDH3A2 pAb (ATL-HPA014769) – 1 Found

Ghazalpour, Anatole; Bennett, Brian; Petyuk, Vladislav A; Orozco, Luz; Hagopian, Raffi; Mungrue, Imran N; Farber, Charles R; Sinsheimer, Janet; Kang, Hyun M; Furlotte, Nicholas; Park, Christopher C; Wen, Ping-Zi; Brewer, Heather; Weitz, Karl; Camp, David G 2nd; Pan, Calvin; Yordanova, Roumyana; Neuhaus, Isaac; Tilford, Charles; Siemers, Nathan; Gargalovic, Peter; Eskin, Eleazar; Kirchgessner, Todd; Smith, Desmond J; Smith, Richard D; Lusis, Aldons J. Comparative analysis of proteome and transcriptome variation in mouse. Plos Genetics. 2011;7(6):e1001393.