Anti ALDH3A1 pAb (ATL-HPA051150 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA051150-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 3 family, member A1
Gene Name: ALDH3A1
Alternative Gene Name: ALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019102: 81%, ENSRNOG00000002331: 79%
Entrez Gene ID: 218
Uniprot ID: P30838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
Gene Sequence NSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
Gene ID - Mouse ENSMUSG00000019102
Gene ID - Rat ENSRNOG00000002331
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH3A1 pAb (ATL-HPA051150 w/enhanced validation)
Datasheet Anti ALDH3A1 pAb (ATL-HPA051150 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH3A1 pAb (ATL-HPA051150 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALDH3A1 pAb (ATL-HPA051150 w/enhanced validation)
Datasheet Anti ALDH3A1 pAb (ATL-HPA051150 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH3A1 pAb (ATL-HPA051150 w/enhanced validation)