Anti ALDH1L2 pAb (ATL-HPA059282)

Atlas Antibodies

Catalog No.:
ATL-HPA059282-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 1 family member L2
Gene Name: ALDH1L2
Alternative Gene Name: FLJ38508, mtFDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020256: 79%, ENSRNOG00000008586: 85%
Entrez Gene ID: 160428
Uniprot ID: Q3SY69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT
Gene Sequence KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT
Gene ID - Mouse ENSMUSG00000020256
Gene ID - Rat ENSRNOG00000008586
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH1L2 pAb (ATL-HPA059282)
Datasheet Anti ALDH1L2 pAb (ATL-HPA059282) Datasheet (External Link)
Vendor Page Anti ALDH1L2 pAb (ATL-HPA059282) at Atlas Antibodies

Documents & Links for Anti ALDH1L2 pAb (ATL-HPA059282)
Datasheet Anti ALDH1L2 pAb (ATL-HPA059282) Datasheet (External Link)
Vendor Page Anti ALDH1L2 pAb (ATL-HPA059282)