Anti ALDH1L2 pAb (ATL-HPA039481)

Atlas Antibodies

SKU: ATL-HPA039481-25

• 
• 

Protein Description: aldehyde dehydrogenase 1 family, member L2
Gene Name: ALDH1L2
Alternative Gene Name: FLJ38508, mtFDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020256: 92%, ENSRNOG00000008586: 93%
Entrez Gene ID: 160428
Uniprot ID: Q3SY69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
• Gene Sequence: FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
• Gene ID - Mouse: ENSMUSG00000020256
• Gene ID - Rat: ENSRNOG00000008586
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.