Anti ALDH1L1 pAb (ATL-HPA050139 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050139-25

• 
• 

Protein Description: aldehyde dehydrogenase 1 family, member L1
Gene Name: ALDH1L1
Alternative Gene Name: 10-fTHF, FTHFD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030088: 83%, ENSRNOG00000047023: 80%
Entrez Gene ID: 10840
Uniprot ID: O75891
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINP
• Gene Sequence: EVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINP
• Gene ID - Mouse: ENSMUSG00000030088
• Gene ID - Rat: ENSRNOG00000047023
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDH1L1 pAb (ATL-HPA050139 w/enhanced validation) – 1 Found

Pandit, Kunal; Petrescu, Joana; Cuevas, Miguel; Stephenson, William; Smibert, Peter; Phatnani, Hemali; Maniatis, Silas. An open source toolkit for repurposing Illumina sequencing systems as versatile fluidics and imaging platforms. Scientific Reports. 2022;12(1):5081.