Gene Name: ALDH1L1
Alternative Gene Name: 10-fTHF, FTHFD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030088: 83%, ENSRNOG00000047023: 84%
Entrez Gene ID: 10840
Uniprot ID: O75891
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDF |
| Gene Sequence | ILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDF |
| Gene ID - Mouse | ENSMUSG00000030088 |
| Gene ID - Rat | ENSRNOG00000047023 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) | |
| Datasheet | Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) | |
| Datasheet | Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) |