Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036900-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 1 family, member L1
Gene Name: ALDH1L1
Alternative Gene Name: 10-fTHF, FTHFD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030088: 83%, ENSRNOG00000047023: 84%
Entrez Gene ID: 10840
Uniprot ID: O75891
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDF
Gene Sequence ILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDF
Gene ID - Mouse ENSMUSG00000030088
Gene ID - Rat ENSRNOG00000047023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation)
Datasheet Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation)
Datasheet Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH1L1 pAb (ATL-HPA036900 w/enhanced validation)