Anti ALDH1B1 pAb (ATL-HPA077080)

Atlas Antibodies

SKU:
ATL-HPA077080-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 1 family member B1
Gene Name: ALDH1B1
Alternative Gene Name: ALDH5, ALDHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035561: 94%, ENSRNOG00000011497: 90%
Entrez Gene ID: 219
Uniprot ID: P30837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
Gene Sequence ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
Gene ID - Mouse ENSMUSG00000035561
Gene ID - Rat ENSRNOG00000011497
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALDH1B1 pAb (ATL-HPA077080)
Datasheet Anti ALDH1B1 pAb (ATL-HPA077080) Datasheet (External Link)
Vendor Page Anti ALDH1B1 pAb (ATL-HPA077080) at Atlas Antibodies

Documents & Links for Anti ALDH1B1 pAb (ATL-HPA077080)
Datasheet Anti ALDH1B1 pAb (ATL-HPA077080) Datasheet (External Link)
Vendor Page Anti ALDH1B1 pAb (ATL-HPA077080)