Anti ALDH1B1 pAb (ATL-HPA077080)

Atlas Antibodies

Catalog No.:
ATL-HPA077080-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 1 family member B1
Gene Name: ALDH1B1
Alternative Gene Name: ALDH5, ALDHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035561: 94%, ENSRNOG00000011497: 90%
Entrez Gene ID: 219
Uniprot ID: P30837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
Gene Sequence ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
Gene ID - Mouse ENSMUSG00000035561
Gene ID - Rat ENSRNOG00000011497
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH1B1 pAb (ATL-HPA077080)
Datasheet Anti ALDH1B1 pAb (ATL-HPA077080) Datasheet (External Link)
Vendor Page Anti ALDH1B1 pAb (ATL-HPA077080) at Atlas Antibodies

Documents & Links for Anti ALDH1B1 pAb (ATL-HPA077080)
Datasheet Anti ALDH1B1 pAb (ATL-HPA077080) Datasheet (External Link)
Vendor Page Anti ALDH1B1 pAb (ATL-HPA077080)