Anti ALDH1B1 pAb (ATL-HPA077080)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077080-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALDH1B1
Alternative Gene Name: ALDH5, ALDHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035561: 94%, ENSRNOG00000011497: 90%
Entrez Gene ID: 219
Uniprot ID: P30837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK |
Gene Sequence | ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK |
Gene ID - Mouse | ENSMUSG00000035561 |
Gene ID - Rat | ENSRNOG00000011497 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALDH1B1 pAb (ATL-HPA077080) | |
Datasheet | Anti ALDH1B1 pAb (ATL-HPA077080) Datasheet (External Link) |
Vendor Page | Anti ALDH1B1 pAb (ATL-HPA077080) at Atlas Antibodies |
Documents & Links for Anti ALDH1B1 pAb (ATL-HPA077080) | |
Datasheet | Anti ALDH1B1 pAb (ATL-HPA077080) Datasheet (External Link) |
Vendor Page | Anti ALDH1B1 pAb (ATL-HPA077080) |