Anti ALDH1A3 pAb (ATL-HPA064749)

Atlas Antibodies

SKU:
ATL-HPA064749-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 1 family, member A3
Gene Name: ALDH1A3
Alternative Gene Name: ALDH6, RALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015134: 84%, ENSRNOG00000052070: 84%
Entrez Gene ID: 220
Uniprot ID: P47895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF
Gene Sequence TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF
Gene ID - Mouse ENSMUSG00000015134
Gene ID - Rat ENSRNOG00000052070
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALDH1A3 pAb (ATL-HPA064749)
Datasheet Anti ALDH1A3 pAb (ATL-HPA064749) Datasheet (External Link)
Vendor Page Anti ALDH1A3 pAb (ATL-HPA064749) at Atlas Antibodies

Documents & Links for Anti ALDH1A3 pAb (ATL-HPA064749)
Datasheet Anti ALDH1A3 pAb (ATL-HPA064749) Datasheet (External Link)
Vendor Page Anti ALDH1A3 pAb (ATL-HPA064749)