Anti ALDH1A3 pAb (ATL-HPA064749)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064749-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALDH1A3
Alternative Gene Name: ALDH6, RALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015134: 84%, ENSRNOG00000052070: 84%
Entrez Gene ID: 220
Uniprot ID: P47895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF |
Gene Sequence | TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF |
Gene ID - Mouse | ENSMUSG00000015134 |
Gene ID - Rat | ENSRNOG00000052070 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALDH1A3 pAb (ATL-HPA064749) | |
Datasheet | Anti ALDH1A3 pAb (ATL-HPA064749) Datasheet (External Link) |
Vendor Page | Anti ALDH1A3 pAb (ATL-HPA064749) at Atlas Antibodies |
Documents & Links for Anti ALDH1A3 pAb (ATL-HPA064749) | |
Datasheet | Anti ALDH1A3 pAb (ATL-HPA064749) Datasheet (External Link) |
Vendor Page | Anti ALDH1A3 pAb (ATL-HPA064749) |