Anti ALDH1A3 pAb (ATL-HPA064749)

Atlas Antibodies

Catalog No.: ATL-HPA064749-25

Protein Description: aldehyde dehydrogenase 1 family, member A3
Gene Name: ALDH1A3
Alternative Gene Name: ALDH6, RALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015134: 84%, ENSRNOG00000052070: 84%
Entrez Gene ID: 220
Uniprot ID: P47895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF
• Gene Sequence: TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF
• Gene ID - Mouse: ENSMUSG00000015134
• Gene ID - Rat: ENSRNOG00000052070
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.