Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046271-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALDH1A3
Alternative Gene Name: ALDH6, RALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015134: 83%, ENSRNOG00000052070: 83%
Entrez Gene ID: 220
Uniprot ID: P47895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN |
Gene Sequence | ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN |
Gene ID - Mouse | ENSMUSG00000015134 |
Gene ID - Rat | ENSRNOG00000052070 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) | |
Datasheet | Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) | |
Datasheet | Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) |
Citations for Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) – 3 Found |
Shehata, Mona; Kim, Hyeyeon; Vellanki, Ravi; Waterhouse, Paul D; Mahendralingam, Mathepan; Casey, Alison E; Koritzinsky, Marianne; Khokha, Rama. Identifying the murine mammary cell target of metformin exposure. Communications Biology. 2( 31123716):192. PubMed |
Giraddi, Rajshekhar R; Shehata, Mona; Gallardo, Mercedes; Blasco, Maria A; Simons, Benjamin D; Stingl, John. Stem and progenitor cell division kinetics during postnatal mouse mammary gland development. Nature Communications. 2015;6( 26511661):8487. PubMed |
Nie, Shuang; Qian, Xuetian; Shi, Mengyue; Li, Hongzhen; Peng, Chunyan; Ding, Xiwei; Zhang, Shu; Zhang, Bin; Xu, Guifang; Lv, Ying; Wang, Lei; Friess, Helmut; Kong, Bo; Zou, Xiaoping; Shen, Shanshan. ALDH1A3 Accelerates Pancreatic Cancer Metastasis by Promoting Glucose Metabolism. Frontiers In Oncology. 10( 32612951):915. PubMed |