Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046271-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aldehyde dehydrogenase 1 family, member A3
Gene Name: ALDH1A3
Alternative Gene Name: ALDH6, RALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015134: 83%, ENSRNOG00000052070: 83%
Entrez Gene ID: 220
Uniprot ID: P47895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN
Gene Sequence ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN
Gene ID - Mouse ENSMUSG00000015134
Gene ID - Rat ENSRNOG00000052070
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation)
Datasheet Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation)
Datasheet Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation)
Citations for Anti ALDH1A3 pAb (ATL-HPA046271 w/enhanced validation) – 3 Found
Shehata, Mona; Kim, Hyeyeon; Vellanki, Ravi; Waterhouse, Paul D; Mahendralingam, Mathepan; Casey, Alison E; Koritzinsky, Marianne; Khokha, Rama. Identifying the murine mammary cell target of metformin exposure. Communications Biology. 2( 31123716):192.  PubMed
Giraddi, Rajshekhar R; Shehata, Mona; Gallardo, Mercedes; Blasco, Maria A; Simons, Benjamin D; Stingl, John. Stem and progenitor cell division kinetics during postnatal mouse mammary gland development. Nature Communications. 2015;6( 26511661):8487.  PubMed
Nie, Shuang; Qian, Xuetian; Shi, Mengyue; Li, Hongzhen; Peng, Chunyan; Ding, Xiwei; Zhang, Shu; Zhang, Bin; Xu, Guifang; Lv, Ying; Wang, Lei; Friess, Helmut; Kong, Bo; Zou, Xiaoping; Shen, Shanshan. ALDH1A3 Accelerates Pancreatic Cancer Metastasis by Promoting Glucose Metabolism. Frontiers In Oncology. 10( 32612951):915.  PubMed