Anti ALDH1A2 pAb (ATL-HPA010022 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA010022-25

• 
• 

Protein Description: aldehyde dehydrogenase 1 family, member A2
Gene Name: ALDH1A2
Alternative Gene Name: RALDH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013584: 98%, ENSRNOG00000055049: 98%
Entrez Gene ID: 8854
Uniprot ID: O94788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
• Gene Sequence: VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
• Gene ID - Mouse: ENSMUSG00000013584
• Gene ID - Rat: ENSRNOG00000055049
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDH1A2 pAb (ATL-HPA010022 w/enhanced validation) – 16 Found

Penny, Hweixian Leong; Prestwood, Tyler R; Bhattacharya, Nupur; Sun, Fionna; Kenkel, Justin A; Davidson, Matthew G; Shen, Lei; Zuniga, Luis A; Seeley, E Scott; Pai, Reetesh; Choi, Okmi; Tolentino, Lorna; Wang, Jinshan; Napoli, Joseph L; Engleman, Edgar G. Restoring Retinoic Acid Attenuates Intestinal Inflammation and Tumorigenesis in APCMin/+ Mice. Cancer Immunology Research. 2016;4(11):917-926. 

Minkina, Anna; Lindeman, Robin E; Gearhart, Micah D; Chassot, Anne-Amandine; Chaboissier, Marie-Christine; Ghyselinck, Norbert B; Bardwell, Vivian J; Zarkower, David. Retinoic acid signaling is dispensable for somatic development and function in the mammalian ovary. Developmental Biology. 2017;424(2):208-220. 

Shepherd, Colin; Zhu, Dongxing; Skelton, Andrew J; Combe, Jennifer; Threadgold, Harrison; Zhu, Linyi; Vincent, Tonia L; Stuart, Paul; Reynard, Louise N; Loughlin, John. Functional Characterization of the Osteoarthritis Genetic Risk Residing at ALDH1A2 Identifies rs12915901 as a Key Target Variant. Arthritis & Rheumatology (Hoboken, N.j.). 2018;70(10):1577-1587. 

Heinrich, Anna; Bhandary, Bidur; Potter, Sarah J; Ratner, Nancy; DeFalco, Tony. Cdc42 activity in Sertoli cells is essential for maintenance of spermatogenesis. Cell Reports. 2021;37(4):109885. 

Zhou, Ran; Chen, Zhuo; Xiao, Zuo-Run; Wang, Shou-Li; Rong, Chao. HPV-Related Promoter Methylation-Based Gene Signature Predicts Clinical Prognosis of Patients With Cervical Cancer. Frontiers In Oncology. 11( 34745985):753102. 

Kostareli, Efterpi; Holzinger, Dana; Bogatyrova, Olga; Hielscher, Thomas; Wichmann, Gunnar; Keck, Michaela; Lahrmann, Bernd; Grabe, Niels; Flechtenmacher, Christa; Schmidt, Christopher R; Seiwert, Tanguy; Dyckhoff, Gerhard; Dietz, Andreas; Höfler, Daniela; Pawlita, Michael; Benner, Axel; Bosch, Franz X; Plinkert, Peter; Plass, Christoph; Weichenhan, Dieter; Hess, Jochen. HPV-related methylation signature predicts survival in oropharyngeal squamous cell carcinomas. The Journal Of Clinical Investigation. 2013;123(6):2488-501. 

Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244. 

Harper, Angelica R; Wiechmann, Allan F; Moiseyev, Gennadiy; Ma, Jian-Xing; Summers, Jody A. Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye. Plos One. 10(3):e0122008. 

Seidensaal, Katharina; Nollert, Andre; Feige, Agnes Hiou; Muller, Marie; Fleming, Thomas; Gunkel, Nikolas; Zaoui, Karim; Grabe, Niels; Weichert, Wilko; Weber, Klaus-Josef; Plinkert, Peter; Simon, Christian; Hess, Jochen. Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma. Molecular Cancer. 2015;14( 26634247):204. 

Sato, Yuki; Mii, Akiko; Hamazaki, Yoko; Fujita, Harumi; Nakata, Hirosuke; Masuda, Kyoko; Nishiyama, Shingo; Shibuya, Shinsuke; Haga, Hironori; Ogawa, Osamu; Shimizu, Akira; Narumiya, Shuh; Kaisho, Tsuneyasu; Arita, Makoto; Yanagisawa, Masashi; Miyasaka, Masayuki; Sharma, Kumar; Minato, Nagahiro; Kawamoto, Hiroshi; Yanagita, Motoko. Heterogeneous fibroblasts underlie age-dependent tertiary lymphoid tissues in the kidney. Jci Insight. 2016;1(11):e87680. 

Schäfer, Frank-Mattias; Algarrahi, Khalid; Savarino, Alyssa; Yang, Xuehui; Seager, Catherine; Franck, Debra; Costa, Kyle; Liu, Shanshan; Logvinenko, Tanya; Adam, Rosalyn; Mauney, Joshua R. Mode of Surgical Injury Influences the Source of Urothelial Progenitors during Bladder Defect Repair. Stem Cell Reports. 2017;9(6):2005-2017. 

DiNuoscio, Gregg; Atit, Radhika P. Wnt/β-catenin signaling in the mouse embryonic cranial mesenchyme is required to sustain the emerging differentiated meningeal layers. Genesis (New York, N.y. : 2000). 2019;57(1):e23279. 

Chassot, Anne-Amandine; Le Rolle, Morgane; Jolivet, Geneviève; Stevant, Isabelle; Guigonis, Jean-Marie; Da Silva, Fabio; Nef, Serge; Pailhoux, Eric; Schedl, Andreas; Ghyselinck, Norbert B; Chaboissier, Marie-Christine. Retinoic acid synthesis by ALDH1A proteins is dispensable for meiosis initiation in the mouse fetal ovary. Science Advances. 2020;6(21):eaaz1261. 

Chen, Luoman; Dalton, Stephen. Multipotent Vascular Progenitor Cells of the Mesothelium Lineage Generated from Human Pluripotent Stem Cells. Star Protocols. 2020;1(1):100031. 

DeSisto, John; O'Rourke, Rebecca; Jones, Hannah E; Pawlikowski, Bradley; Malek, Alexandra D; Bonney, Stephanie; Guimiot, Fabien; Jones, Kenneth L; Siegenthaler, Julie A. Single-Cell Transcriptomic Analyses of the Developing Meninges Reveal Meningeal Fibroblast Diversity and Function. Developmental Cell. 2020;54(1):43-59.e4. 

Feng, Wei; Bais, Abha; He, Haoting; Rios, Cassandra; Jiang, Shan; Xu, Juan; Chang, Cindy; Kostka, Dennis; Li, Guang. Single-cell transcriptomic analysis identifies murine heart molecular features at embryonic and neonatal stages. Nature Communications. 2022;13(1):7960.