Anti ALDH1A1 pAb (ATL-HPA002123 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA002123-25

• 
• 
• 

Protein Description: aldehyde dehydrogenase 1 family, member A1
Gene Name: ALDH1A1
Alternative Gene Name: ALDH1, PUMB1, RALDH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053279: 91%, ENSRNOG00000017619: 90%
Entrez Gene ID: 216
Uniprot ID: P00352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
• Gene Sequence: IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
• Gene ID - Mouse: ENSMUSG00000053279
• Gene ID - Rat: ENSRNOG00000017619
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDH1A1 pAb (ATL-HPA002123 w/enhanced validation) – 7 Found

Dorris, Emma R; Blackshields, Gordon; Sommerville, Gary; Alhashemi, Mohsen; Dias, Andrew; McEneaney, Victoria; Smyth, Paul; O'Leary, John J; Sheils, Orla. Pluripotency markers are differentially induced by MEK inhibition in thyroid and melanoma BRAFV600E cell lines. Cancer Biology & Therapy. 2016;17(5):526-42. 

Li, Xiangyan; Wu, Jason Boyang; Li, Qinlong; Shigemura, Katsumi; Chung, Leland W K; Huang, Wen-Chin. SREBP-2 promotes stem cell-like properties and metastasis by transcriptional activation of c-Myc in prostate cancer. Oncotarget. 2016;7(11):12869-84. 

Marie, Anaïs; Leroy, Julien; Darricau, Morgane; Alfos, Serge; De Smedt-Peyrusse, Veronique; Richard, Emmanuel; Vancassel, Sylvie; Bosch-Bouju, Clementine. Preventive Vitamin A Supplementation Improves Striatal Function in 6-Hydroxydopamine Hemiparkinsonian Rats. Frontiers In Nutrition. 9( 35178422):811843. 

Szabo, Akos Z; Fong, Stephen; Yue, Lili; Zhang, Kai; Strachan, Lauren R; Scalapino, Kenneth; Mancianti, Maria Laura; Ghadially, Ruby. The CD44+ ALDH+ population of human keratinocytes is enriched for epidermal stem cells with long-term repopulating ability. Stem Cells (Dayton, Ohio). 2013;31(4):786-99. 

Harper, Angelica R; Wiechmann, Allan F; Moiseyev, Gennadiy; Ma, Jian-Xing; Summers, Jody A. Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye. Plos One. 10(3):e0122008. 

Taylor, Bethany; Rice, Alexandra; Nicholson, Andrew G; Hind, Matthew; Dean, Charlotte H. Mechanism of lung development in the aetiology of adult congenital pulmonary airway malformations. Thorax. 2020;75(11):1001-1003. 

Canesin, Giacomo; Maggio, Valentina; Palominos, Macarena; Stiehm, Anna; Contreras, Hector R; Castellón, Enrique A; Morote, Juan; Paciucci, Rosanna; Maitland, Norman J; Bjartell, Anders; Hellsten, Rebecka. STAT3 inhibition with galiellalactone effectively targets the prostate cancer stem-like cell population. Scientific Reports. 2020;10(1):13958.