Anti ALDH16A1 pAb (ATL-HPA059488)

Atlas Antibodies

Catalog No.: ATL-HPA059488-25

Protein Description: aldehyde dehydrogenase 16 family, member A1
Gene Name: ALDH16A1
Alternative Gene Name: MGC10204
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007833: 80%, ENSRNOG00000020623: 78%
Entrez Gene ID: 126133
Uniprot ID: Q8IZ83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVE
• Gene Sequence: ESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVE
• Gene ID - Mouse: ENSMUSG00000007833
• Gene ID - Rat: ENSRNOG00000020623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.