Anti ALDH16A1 pAb (ATL-HPA059488)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059488-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ALDH16A1
Alternative Gene Name: MGC10204
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007833: 80%, ENSRNOG00000020623: 78%
Entrez Gene ID: 126133
Uniprot ID: Q8IZ83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVE |
| Gene Sequence | ESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVE |
| Gene ID - Mouse | ENSMUSG00000007833 |
| Gene ID - Rat | ENSRNOG00000020623 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH16A1 pAb (ATL-HPA059488) | |
| Datasheet | Anti ALDH16A1 pAb (ATL-HPA059488) Datasheet (External Link) |
| Vendor Page | Anti ALDH16A1 pAb (ATL-HPA059488) at Atlas Antibodies |
| Documents & Links for Anti ALDH16A1 pAb (ATL-HPA059488) | |
| Datasheet | Anti ALDH16A1 pAb (ATL-HPA059488) Datasheet (External Link) |
| Vendor Page | Anti ALDH16A1 pAb (ATL-HPA059488) |