Anti ALB pAb (ATL-HPA031025 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031025-100
Shipping:
Calculated at Checkout
$486.00
Adding to cart… The item has been added
Protein Description: albumin
Gene Name: ALB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029368: 75%, ENSRNOG00000002911: 78%
Entrez Gene ID: 213
Uniprot ID: P02768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQ
Gene Sequence HKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQ
Gene ID - Mouse ENSMUSG00000029368
Gene ID - Rat ENSRNOG00000002911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALB pAb (ATL-HPA031025 w/enhanced validation)
Datasheet Anti ALB pAb (ATL-HPA031025 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALB pAb (ATL-HPA031025 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALB pAb (ATL-HPA031025 w/enhanced validation)
Datasheet Anti ALB pAb (ATL-HPA031025 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALB pAb (ATL-HPA031025 w/enhanced validation)
Citations for Anti ALB pAb (ATL-HPA031025 w/enhanced validation) – 1 Found
Alberio, Tiziana; Forlani, Greta; Lualdi, Marta; Tosi, Giovanna; Accolla, Roberto S; Fasano, Mauro. Neonatal Fc receptor is involved in the protection of fibrinogen after its intake in peripheral blood mononuclear cells. Journal Of Translational Medicine. 2018;16(1):64.  PubMed