Anti ALB pAb (ATL-HPA031025 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031025-100

• 
• 
• 

Protein Description: albumin
Gene Name: ALB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029368: 75%, ENSRNOG00000002911: 78%
Entrez Gene ID: 213
Uniprot ID: P02768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQ
• Gene Sequence: HKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQ
• Gene ID - Mouse: ENSMUSG00000029368
• Gene ID - Rat: ENSRNOG00000002911
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALB pAb (ATL-HPA031025 w/enhanced validation) – 1 Found

Alberio, Tiziana; Forlani, Greta; Lualdi, Marta; Tosi, Giovanna; Accolla, Roberto S; Fasano, Mauro. Neonatal Fc receptor is involved in the protection of fibrinogen after its intake in peripheral blood mononuclear cells. Journal Of Translational Medicine. 2018;16(1):64.