Anti ALB pAb (ATL-HPA031025 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031025-100
- Shipping:
- Calculated at Checkout
$486.00
Gene Name: ALB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029368: 75%, ENSRNOG00000002911: 78%
Entrez Gene ID: 213
Uniprot ID: P02768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQ |
| Gene Sequence | HKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQ |
| Gene ID - Mouse | ENSMUSG00000029368 |
| Gene ID - Rat | ENSRNOG00000002911 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALB pAb (ATL-HPA031025 w/enhanced validation) | |
| Datasheet | Anti ALB pAb (ATL-HPA031025 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALB pAb (ATL-HPA031025 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALB pAb (ATL-HPA031025 w/enhanced validation) | |
| Datasheet | Anti ALB pAb (ATL-HPA031025 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALB pAb (ATL-HPA031025 w/enhanced validation) |
| Citations for Anti ALB pAb (ATL-HPA031025 w/enhanced validation) – 1 Found |
| Alberio, Tiziana; Forlani, Greta; Lualdi, Marta; Tosi, Giovanna; Accolla, Roberto S; Fasano, Mauro. Neonatal Fc receptor is involved in the protection of fibrinogen after its intake in peripheral blood mononuclear cells. Journal Of Translational Medicine. 2018;16(1):64. PubMed |