Anti ALB pAb (ATL-HPA031024 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031024-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: albumin
Gene Name: ALB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029368: 77%, ENSRNOG00000002911: 79%
Entrez Gene ID: 213
Uniprot ID: P02768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF
Gene Sequence ADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF
Gene ID - Mouse ENSMUSG00000029368
Gene ID - Rat ENSRNOG00000002911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALB pAb (ATL-HPA031024 w/enhanced validation)
Datasheet Anti ALB pAb (ATL-HPA031024 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALB pAb (ATL-HPA031024 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALB pAb (ATL-HPA031024 w/enhanced validation)
Datasheet Anti ALB pAb (ATL-HPA031024 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALB pAb (ATL-HPA031024 w/enhanced validation)
Citations for Anti ALB pAb (ATL-HPA031024 w/enhanced validation) – 1 Found
Li, Jie; Rong, Min-Hua; Dang, Yi-Wu; He, Rong-Quan; Lin, Peng; Yang, Hong; Li, Xiao-Jiao; Xiong, Dan-Dan; Zhang, Li-Jie; Qin, Hui; Feng, Cai-Xia; Chen, Xiao-Yi; Zhong, Jin-Cai; Ma, Jie; Chen, Gang. Differentially expressed gene profile and relevant pathways of the traditional Chinese medicine cinobufotalin on MCF‑7 breast cancer cells. Molecular Medicine Reports. 2019;19(5):4256-4270.  PubMed