Anti ALB pAb (ATL-HPA031024 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031024-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ALB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029368: 77%, ENSRNOG00000002911: 79%
Entrez Gene ID: 213
Uniprot ID: P02768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF |
Gene Sequence | ADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF |
Gene ID - Mouse | ENSMUSG00000029368 |
Gene ID - Rat | ENSRNOG00000002911 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALB pAb (ATL-HPA031024 w/enhanced validation) | |
Datasheet | Anti ALB pAb (ATL-HPA031024 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALB pAb (ATL-HPA031024 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ALB pAb (ATL-HPA031024 w/enhanced validation) | |
Datasheet | Anti ALB pAb (ATL-HPA031024 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALB pAb (ATL-HPA031024 w/enhanced validation) |
Citations for Anti ALB pAb (ATL-HPA031024 w/enhanced validation) – 1 Found |
Li, Jie; Rong, Min-Hua; Dang, Yi-Wu; He, Rong-Quan; Lin, Peng; Yang, Hong; Li, Xiao-Jiao; Xiong, Dan-Dan; Zhang, Li-Jie; Qin, Hui; Feng, Cai-Xia; Chen, Xiao-Yi; Zhong, Jin-Cai; Ma, Jie; Chen, Gang. Differentially expressed gene profile and relevant pathways of the traditional Chinese medicine cinobufotalin on MCF‑7 breast cancer cells. Molecular Medicine Reports. 2019;19(5):4256-4270. PubMed |