Anti ALAS2 pAb (ATL-HPA001638)

Atlas Antibodies

SKU:
ATL-HPA001638-25
  • Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aminolevulinate, delta-, synthase 2
Gene Name: ALAS2
Alternative Gene Name: ASB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025270: 91%, ENSRNOG00000000167: 83%
Entrez Gene ID: 212
Uniprot ID: P22557
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHAS
Gene Sequence GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHAS
Gene ID - Mouse ENSMUSG00000025270
Gene ID - Rat ENSRNOG00000000167
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALAS2 pAb (ATL-HPA001638)
Datasheet Anti ALAS2 pAb (ATL-HPA001638) Datasheet (External Link)
Vendor Page Anti ALAS2 pAb (ATL-HPA001638) at Atlas Antibodies

Documents & Links for Anti ALAS2 pAb (ATL-HPA001638)
Datasheet Anti ALAS2 pAb (ATL-HPA001638) Datasheet (External Link)
Vendor Page Anti ALAS2 pAb (ATL-HPA001638)