Anti ALAD pAb (ATL-HPA022124)
Atlas Antibodies
- SKU:
- ATL-HPA022124-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALAD
Alternative Gene Name: ALADH, PBGS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028393: 92%, ENSRNOG00000015206: 92%
Entrez Gene ID: 210
Uniprot ID: P13716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYA |
Gene Sequence | VLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYA |
Gene ID - Mouse | ENSMUSG00000028393 |
Gene ID - Rat | ENSRNOG00000015206 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALAD pAb (ATL-HPA022124) | |
Datasheet | Anti ALAD pAb (ATL-HPA022124) Datasheet (External Link) |
Vendor Page | Anti ALAD pAb (ATL-HPA022124) at Atlas Antibodies |
Documents & Links for Anti ALAD pAb (ATL-HPA022124) | |
Datasheet | Anti ALAD pAb (ATL-HPA022124) Datasheet (External Link) |
Vendor Page | Anti ALAD pAb (ATL-HPA022124) |