Anti ALAD pAb (ATL-HPA022124)

Atlas Antibodies

SKU:
ATL-HPA022124-25
  • Immunohistochemical staining of human stomach shows distinct cytoplasmic positivity in glandular cells.
  • Western blot analysis in human cell line HepG2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aminolevulinate dehydratase
Gene Name: ALAD
Alternative Gene Name: ALADH, PBGS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028393: 92%, ENSRNOG00000015206: 92%
Entrez Gene ID: 210
Uniprot ID: P13716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYA
Gene Sequence VLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYA
Gene ID - Mouse ENSMUSG00000028393
Gene ID - Rat ENSRNOG00000015206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALAD pAb (ATL-HPA022124)
Datasheet Anti ALAD pAb (ATL-HPA022124) Datasheet (External Link)
Vendor Page Anti ALAD pAb (ATL-HPA022124) at Atlas Antibodies

Documents & Links for Anti ALAD pAb (ATL-HPA022124)
Datasheet Anti ALAD pAb (ATL-HPA022124) Datasheet (External Link)
Vendor Page Anti ALAD pAb (ATL-HPA022124)