Anti AKTIP pAb (ATL-HPA046300)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046300-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AKTIP
Alternative Gene Name: FLJ13258, FTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031667: 99%, ENSRNOG00000011956: 99%
Entrez Gene ID: 64400
Uniprot ID: Q9H8T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEK |
| Gene Sequence | LNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEK |
| Gene ID - Mouse | ENSMUSG00000031667 |
| Gene ID - Rat | ENSRNOG00000011956 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKTIP pAb (ATL-HPA046300) | |
| Datasheet | Anti AKTIP pAb (ATL-HPA046300) Datasheet (External Link) |
| Vendor Page | Anti AKTIP pAb (ATL-HPA046300) at Atlas Antibodies |
| Documents & Links for Anti AKTIP pAb (ATL-HPA046300) | |
| Datasheet | Anti AKTIP pAb (ATL-HPA046300) Datasheet (External Link) |
| Vendor Page | Anti AKTIP pAb (ATL-HPA046300) |
| Citations for Anti AKTIP pAb (ATL-HPA046300) – 1 Found |
| Feng, Zhen; Yu, Cheng-Han. PI(3,4)P(2)-mediated membrane tubulation promotes integrin trafficking and invasive cell migration. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(19) PubMed |