Anti AKTIP pAb (ATL-HPA046300)

Atlas Antibodies

Catalog No.:
ATL-HPA046300-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: AKT interacting protein
Gene Name: AKTIP
Alternative Gene Name: FLJ13258, FTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031667: 99%, ENSRNOG00000011956: 99%
Entrez Gene ID: 64400
Uniprot ID: Q9H8T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEK
Gene Sequence LNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEK
Gene ID - Mouse ENSMUSG00000031667
Gene ID - Rat ENSRNOG00000011956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AKTIP pAb (ATL-HPA046300)
Datasheet Anti AKTIP pAb (ATL-HPA046300) Datasheet (External Link)
Vendor Page Anti AKTIP pAb (ATL-HPA046300) at Atlas Antibodies

Documents & Links for Anti AKTIP pAb (ATL-HPA046300)
Datasheet Anti AKTIP pAb (ATL-HPA046300) Datasheet (External Link)
Vendor Page Anti AKTIP pAb (ATL-HPA046300)
Citations for Anti AKTIP pAb (ATL-HPA046300) – 1 Found
Feng, Zhen; Yu, Cheng-Han. PI(3,4)P(2)-mediated membrane tubulation promotes integrin trafficking and invasive cell migration. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(19)  PubMed