Anti AKTIP pAb (ATL-HPA041794)

Atlas Antibodies

SKU: ATL-HPA041794-25

• 

Protein Description: AKT interacting protein
Gene Name: AKTIP
Alternative Gene Name: FLJ13258, FTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031667: 98%, ENSRNOG00000011956: 98%
Entrez Gene ID: 64400
Uniprot ID: Q9H8T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASP
• Gene Sequence: WFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASP
• Gene ID - Mouse: ENSMUSG00000031667
• Gene ID - Rat: ENSRNOG00000011956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKTIP pAb (ATL-HPA041794) – 2 Found

Merigliano, Chiara; Burla, Romina; La Torre, Mattia; Del Giudice, Simona; Teo, Hsiangling; Liew, Chong Wai; Chojnowski, Alexandre; Goh, Wah Ing; Olmos, Yolanda; Maccaroni, Klizia; Giubettini, Maria; Chiolo, Irene; Carlton, Jeremy G; Raimondo, Domenico; Vernì, Fiammetta; Stewart, Colin L; Rhodes, Daniela; Wright, Graham D; Burke, Brian E; Saggio, Isabella. AKTIP interacts with ESCRT I and is needed for the recruitment of ESCRT III subunits to the midbody. Plos Genetics. 2021;17(8):e1009757. 

La Torre, Mattia; Merigliano, Chiara; Maccaroni, Klizia; Chojnowski, Alexandre; Goh, Wah Ing; Giubettini, Maria; Vernì, Fiammetta; Capanni, Cristina; Rhodes, Daniela; Wright, Graham; Burke, Brian; Soddu, Silvia; Burla, Romina; Saggio, Isabella. Combined alteration of lamin and nuclear morphology influences the localization of the tumor-associated factor AKTIP. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):273.