Anti AKTIP pAb (ATL-HPA041794)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041794-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AKTIP
Alternative Gene Name: FLJ13258, FTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031667: 98%, ENSRNOG00000011956: 98%
Entrez Gene ID: 64400
Uniprot ID: Q9H8T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASP |
| Gene Sequence | WFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASP |
| Gene ID - Mouse | ENSMUSG00000031667 |
| Gene ID - Rat | ENSRNOG00000011956 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKTIP pAb (ATL-HPA041794) | |
| Datasheet | Anti AKTIP pAb (ATL-HPA041794) Datasheet (External Link) |
| Vendor Page | Anti AKTIP pAb (ATL-HPA041794) at Atlas Antibodies |
| Documents & Links for Anti AKTIP pAb (ATL-HPA041794) | |
| Datasheet | Anti AKTIP pAb (ATL-HPA041794) Datasheet (External Link) |
| Vendor Page | Anti AKTIP pAb (ATL-HPA041794) |
| Citations for Anti AKTIP pAb (ATL-HPA041794) – 2 Found |
| Merigliano, Chiara; Burla, Romina; La Torre, Mattia; Del Giudice, Simona; Teo, Hsiangling; Liew, Chong Wai; Chojnowski, Alexandre; Goh, Wah Ing; Olmos, Yolanda; Maccaroni, Klizia; Giubettini, Maria; Chiolo, Irene; Carlton, Jeremy G; Raimondo, Domenico; Vernì, Fiammetta; Stewart, Colin L; Rhodes, Daniela; Wright, Graham D; Burke, Brian E; Saggio, Isabella. AKTIP interacts with ESCRT I and is needed for the recruitment of ESCRT III subunits to the midbody. Plos Genetics. 2021;17(8):e1009757. PubMed |
| La Torre, Mattia; Merigliano, Chiara; Maccaroni, Klizia; Chojnowski, Alexandre; Goh, Wah Ing; Giubettini, Maria; Vernì, Fiammetta; Capanni, Cristina; Rhodes, Daniela; Wright, Graham; Burke, Brian; Soddu, Silvia; Burla, Romina; Saggio, Isabella. Combined alteration of lamin and nuclear morphology influences the localization of the tumor-associated factor AKTIP. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):273. PubMed |