Anti AKT3 pAb (ATL-HPA026441)

Atlas Antibodies

Catalog No.: ATL-HPA026441-25

Protein Description: v-akt murine thymoma viral oncogene homolog 3
Gene Name: AKT3
Alternative Gene Name: PKBG, PRKBG, RAC-gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019699: 100%, ENSRNOG00000021497: 100%
Entrez Gene ID: 10000
Uniprot ID: Q9Y243
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
• Gene Sequence: EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
• Gene ID - Mouse: ENSMUSG00000019699
• Gene ID - Rat: ENSRNOG00000021497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKT3 pAb (ATL-HPA026441) – 3 Found

Vredeveld, Liesbeth C W; Possik, Patricia A; Smit, Marjon A; Meissl, Katrin; Michaloglou, Chrysiis; Horlings, Hugo M; Ajouaou, Abderrahim; Kortman, Pim C; Dankort, David; McMahon, Martin; Mooi, Wolter J; Peeper, Daniel S. Abrogation of BRAFV600E-induced senescence by PI3K pathway activation contributes to melanomagenesis. Genes & Development. 2012;26(10):1055-69. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

O'Hurley, Gillian; Daly, Etáin; O'Grady, Anthony; Cummins, Robert; Quinn, Cecily; Flanagan, Louise; Pierce, Aisling; Fan, Yue; Lynn, Miriam A; Rafferty, Máirín; Fitzgerald, Dara; Pontén, Fredrik; Duffy, Michael J; Jirström, Karin; Kay, Elaine W; Gallagher, William M. Investigation of molecular alterations of AKT-3 in triple-negative breast cancer. Histopathology. 2014;64(5):660-70.