Anti AKT2 pAb (ATL-HPA064521)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064521-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: AKT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004056: 92%, ENSRNOG00000018677: 92%
Entrez Gene ID: 208
Uniprot ID: P31751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND |
| Gene Sequence | HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND |
| Gene ID - Mouse | ENSMUSG00000004056 |
| Gene ID - Rat | ENSRNOG00000018677 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKT2 pAb (ATL-HPA064521) | |
| Datasheet | Anti AKT2 pAb (ATL-HPA064521) Datasheet (External Link) |
| Vendor Page | Anti AKT2 pAb (ATL-HPA064521) at Atlas Antibodies |
| Documents & Links for Anti AKT2 pAb (ATL-HPA064521) | |
| Datasheet | Anti AKT2 pAb (ATL-HPA064521) Datasheet (External Link) |
| Vendor Page | Anti AKT2 pAb (ATL-HPA064521) |
| Citations for Anti AKT2 pAb (ATL-HPA064521) – 1 Found |
| Zhou, Kun; Chen, Qiaoli; Chen, Jiamou; Liang, Derong; Feng, Weikuan; Liu, Minjun; Wang, Qi; Wang, Ruizhen; Ouyang, Qian; Quan, Chao; Chen, Shuai. Spatiotemporal regulation of insulin signaling by liquid-liquid phase separation. Cell Discovery. 2022;8(1):64. PubMed |