Anti AKT1S1 pAb (ATL-HPA064427)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064427-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: AKT1S1
Alternative Gene Name: Lobe, MGC2865, PRAS40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011096: 99%, ENSRNOG00000020289: 97%
Entrez Gene ID: 84335
Uniprot ID: Q96B36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK |
| Gene Sequence | KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK |
| Gene ID - Mouse | ENSMUSG00000011096 |
| Gene ID - Rat | ENSRNOG00000020289 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKT1S1 pAb (ATL-HPA064427) | |
| Datasheet | Anti AKT1S1 pAb (ATL-HPA064427) Datasheet (External Link) |
| Vendor Page | Anti AKT1S1 pAb (ATL-HPA064427) at Atlas Antibodies |
| Documents & Links for Anti AKT1S1 pAb (ATL-HPA064427) | |
| Datasheet | Anti AKT1S1 pAb (ATL-HPA064427) Datasheet (External Link) |
| Vendor Page | Anti AKT1S1 pAb (ATL-HPA064427) |