Anti AKT1S1 pAb (ATL-HPA043590)

Atlas Antibodies

Catalog No.:
ATL-HPA043590-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: AKT1 substrate 1 (proline-rich)
Gene Name: AKT1S1
Alternative Gene Name: Lobe, MGC2865, PRAS40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011096: 99%, ENSRNOG00000020289: 97%
Entrez Gene ID: 84335
Uniprot ID: Q96B36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK
Gene Sequence KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK
Gene ID - Mouse ENSMUSG00000011096
Gene ID - Rat ENSRNOG00000020289
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AKT1S1 pAb (ATL-HPA043590)
Datasheet Anti AKT1S1 pAb (ATL-HPA043590) Datasheet (External Link)
Vendor Page Anti AKT1S1 pAb (ATL-HPA043590) at Atlas Antibodies

Documents & Links for Anti AKT1S1 pAb (ATL-HPA043590)
Datasheet Anti AKT1S1 pAb (ATL-HPA043590) Datasheet (External Link)
Vendor Page Anti AKT1S1 pAb (ATL-HPA043590)