Anti AKR7A2 pAb (ATL-HPA064638)

Atlas Antibodies

Catalog No.: ATL-HPA064638-25

Protein Description: aldo-keto reductase family 7, member A2
Gene Name: AKR7A2
Alternative Gene Name: AFAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028743: 97%, ENSRNOG00000017780: 95%
Entrez Gene ID: 8574
Uniprot ID: O43488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQ
• Gene Sequence: LHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQ
• Gene ID - Mouse: ENSMUSG00000028743
• Gene ID - Rat: ENSRNOG00000017780
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.