Anti AKR1E2 pAb (ATL-HPA037822 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037822-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aldo-keto reductase family 1, member E2
Gene Name: AKR1E2
Alternative Gene Name: AKR1CL2, AKRDC1, MGC10612
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045410: 44%, ENSRNOG00000017165: 48%
Entrez Gene ID: 83592
Uniprot ID: Q96JD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIG
Gene Sequence MGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIG
Gene ID - Mouse ENSMUSG00000045410
Gene ID - Rat ENSRNOG00000017165
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AKR1E2 pAb (ATL-HPA037822 w/enhanced validation)
Datasheet Anti AKR1E2 pAb (ATL-HPA037822 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AKR1E2 pAb (ATL-HPA037822 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AKR1E2 pAb (ATL-HPA037822 w/enhanced validation)
Datasheet Anti AKR1E2 pAb (ATL-HPA037822 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AKR1E2 pAb (ATL-HPA037822 w/enhanced validation)