Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057002-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: AKR1D1
Alternative Gene Name: SRD5B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038641: 63%, ENSRNOG00000013004: 65%
Entrez Gene ID: 6718
Uniprot ID: P51857
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTG |
| Gene Sequence | MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTG |
| Gene ID - Mouse | ENSMUSG00000038641 |
| Gene ID - Rat | ENSRNOG00000013004 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation) | |
| Datasheet | Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation) | |
| Datasheet | Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation) |
| Citations for Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation) – 4 Found |
| Nikolaou, Nikolaos; Gathercole, Laura L; Kirkwood, Lucy; Dunford, James E; Hughes, Beverly A; Gilligan, Lorna C; Oppermann, Udo; Penning, Trevor M; Arlt, Wiebke; Hodson, Leanne; Tomlinson, Jeremy W. AKR1D1 regulates glucocorticoid availability and glucocorticoid receptor activation in human hepatoma cells. The Journal Of Steroid Biochemistry And Molecular Biology. 2019;189( 30769091):218-227. PubMed |
| Nikolaou, Nikolaos; Gathercole, Laura L; Marchand, Lea; Althari, Sara; Dempster, Niall J; Green, Charlotte J; van de Bunt, Martijn; McNeil, Catriona; Arvaniti, Anastasia; Hughes, Beverly A; Sgromo, Bruno; Gillies, Richard S; Marschall, Hanns-Ulrich; Penning, Trevor M; Ryan, John; Arlt, Wiebke; Hodson, Leanne; Tomlinson, Jeremy W. AKR1D1 is a novel regulator of metabolic phenotype in human hepatocytes and is dysregulated in non-alcoholic fatty liver disease. Metabolism: Clinical And Experimental. 2019;99( 31330134):67-80. PubMed |
| Nikolaou, Nikolaos; Arvaniti, Anastasia; Appanna, Nathan; Sharp, Anna; Hughes, Beverly A; Digweed, Dena; Whitaker, Martin J; Ross, Richard; Arlt, Wiebke; Penning, Trevor M; Morris, Karen; George, Sherly; Keevil, Brian G; Hodson, Leanne; Gathercole, Laura L; Tomlinson, Jeremy W. Glucocorticoids regulate AKR1D1 activity in human liver in vitro and in vivo. The Journal Of Endocrinology. 2020;245(2):207-218. PubMed |
| Appanna, Nathan; Gibson, Hylton; Gangitano, Elena; Dempster, Niall J; Morris, Karen; George, Sherly; Arvaniti, Anastasia; Gathercole, Laura L; Keevil, Brian; Penning, Trevor M; Storbeck, Karl-Heinz; Tomlinson, Jeremy W; Nikolaou, Nikolaos. Differential activity and expression of human 5β-reductase (AKR1D1) splice variants. Journal Of Molecular Endocrinology. 2021;66(3):181-194. PubMed |