Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA057002-100

• 
• 

Protein Description: aldo-keto reductase family 1, member D1
Gene Name: AKR1D1
Alternative Gene Name: SRD5B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038641: 63%, ENSRNOG00000013004: 65%
Entrez Gene ID: 6718
Uniprot ID: P51857
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTG
• Gene Sequence: MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTG
• Gene ID - Mouse: ENSMUSG00000038641
• Gene ID - Rat: ENSRNOG00000013004
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKR1D1 pAb (ATL-HPA057002 w/enhanced validation) – 4 Found

Nikolaou, Nikolaos; Gathercole, Laura L; Kirkwood, Lucy; Dunford, James E; Hughes, Beverly A; Gilligan, Lorna C; Oppermann, Udo; Penning, Trevor M; Arlt, Wiebke; Hodson, Leanne; Tomlinson, Jeremy W. AKR1D1 regulates glucocorticoid availability and glucocorticoid receptor activation in human hepatoma cells. The Journal Of Steroid Biochemistry And Molecular Biology. 2019;189( 30769091):218-227. 

Nikolaou, Nikolaos; Gathercole, Laura L; Marchand, Lea; Althari, Sara; Dempster, Niall J; Green, Charlotte J; van de Bunt, Martijn; McNeil, Catriona; Arvaniti, Anastasia; Hughes, Beverly A; Sgromo, Bruno; Gillies, Richard S; Marschall, Hanns-Ulrich; Penning, Trevor M; Ryan, John; Arlt, Wiebke; Hodson, Leanne; Tomlinson, Jeremy W. AKR1D1 is a novel regulator of metabolic phenotype in human hepatocytes and is dysregulated in non-alcoholic fatty liver disease. Metabolism: Clinical And Experimental. 2019;99( 31330134):67-80. 

Nikolaou, Nikolaos; Arvaniti, Anastasia; Appanna, Nathan; Sharp, Anna; Hughes, Beverly A; Digweed, Dena; Whitaker, Martin J; Ross, Richard; Arlt, Wiebke; Penning, Trevor M; Morris, Karen; George, Sherly; Keevil, Brian G; Hodson, Leanne; Gathercole, Laura L; Tomlinson, Jeremy W. Glucocorticoids regulate AKR1D1 activity in human liver in vitro and in vivo. The Journal Of Endocrinology. 2020;245(2):207-218. 

Appanna, Nathan; Gibson, Hylton; Gangitano, Elena; Dempster, Niall J; Morris, Karen; George, Sherly; Arvaniti, Anastasia; Gathercole, Laura L; Keevil, Brian; Penning, Trevor M; Storbeck, Karl-Heinz; Tomlinson, Jeremy W; Nikolaou, Nikolaos. Differential activity and expression of human 5β-reductase (AKR1D1) splice variants. Journal Of Molecular Endocrinology. 2021;66(3):181-194.