Anti AKR1B10 pAb (ATL-HPA020280 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA020280-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol.
  • Western blot analysis in human cell lines A-549 and HEK293 using Anti-AKR1B10 antibody. Corresponding AKR1B10 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: aldo-keto reductase family 1, member B10 (aldose reductase)
Gene Name: AKR1B10
Alternative Gene Name: AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061758: 63%, ENSRNOG00000009734: 68%
Entrez Gene ID: 57016
Uniprot ID: O60218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT
Gene Sequence PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT
Gene ID - Mouse ENSMUSG00000061758
Gene ID - Rat ENSRNOG00000009734
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti AKR1B10 pAb (ATL-HPA020280 w/enhanced validation)
Datasheet Anti AKR1B10 pAb (ATL-HPA020280 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AKR1B10 pAb (ATL-HPA020280 w/enhanced validation)