Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA026425-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: aldo-keto reductase family 1, member B1 (aldose reductase)
Gene Name: AKR1B1
Alternative Gene Name: ALDR1, AR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001642: 80%, ENSRNOG00000009513: 80%
Entrez Gene ID: 231
Uniprot ID: P15121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
Gene Sequence CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
Gene ID - Mouse ENSMUSG00000001642
Gene ID - Rat ENSRNOG00000009513
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation)
Datasheet Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation)
Datasheet Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation)
Citations for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) – 1 Found
Mateo-Otero, Yentel; Ribas-Maynou, Jordi; Delgado-Bermúdez, Ariadna; Llavanera, Marc; Recuero, Sandra; Barranco, Isabel; Yeste, Marc. Aldose Reductase B1 in Pig Sperm Is Related to Their Function and Fertilizing Ability. Frontiers In Endocrinology. 13( 35173684):773249.  PubMed