Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA026425-25

• 
• 

Protein Description: aldo-keto reductase family 1, member B1 (aldose reductase)
Gene Name: AKR1B1
Alternative Gene Name: ALDR1, AR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001642: 80%, ENSRNOG00000009513: 80%
Entrez Gene ID: 231
Uniprot ID: P15121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
• Gene Sequence: CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
• Gene ID - Mouse: ENSMUSG00000001642
• Gene ID - Rat: ENSRNOG00000009513
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) – 1 Found

Mateo-Otero, Yentel; Ribas-Maynou, Jordi; Delgado-Bermúdez, Ariadna; Llavanera, Marc; Recuero, Sandra; Barranco, Isabel; Yeste, Marc. Aldose Reductase B1 in Pig Sperm Is Related to Their Function and Fertilizing Ability. Frontiers In Endocrinology. 13( 35173684):773249.