Anti AKR1A1 pAb (ATL-HPA017919)

Atlas Antibodies

Catalog No.:
ATL-HPA017919-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aldo-keto reductase family 1, member A1 (aldehyde reductase)
Gene Name: AKR1A1
Alternative Gene Name: ALR, DD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028692: 91%, ENSRNOG00000016727: 93%
Entrez Gene ID: 10327
Uniprot ID: P14550
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMH
Gene Sequence KYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMH
Gene ID - Mouse ENSMUSG00000028692
Gene ID - Rat ENSRNOG00000016727
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AKR1A1 pAb (ATL-HPA017919)
Datasheet Anti AKR1A1 pAb (ATL-HPA017919) Datasheet (External Link)
Vendor Page Anti AKR1A1 pAb (ATL-HPA017919) at Atlas Antibodies

Documents & Links for Anti AKR1A1 pAb (ATL-HPA017919)
Datasheet Anti AKR1A1 pAb (ATL-HPA017919) Datasheet (External Link)
Vendor Page Anti AKR1A1 pAb (ATL-HPA017919)