Anti AKNAD1 pAb (ATL-HPA030272)

Atlas Antibodies

Catalog No.:
ATL-HPA030272-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: AKNA domain containing 1
Gene Name: AKNAD1
Alternative Gene Name: C1orf62, MGC26989
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049565: 50%, ENSRNOG00000028025: 41%
Entrez Gene ID: 254268
Uniprot ID: Q5T1N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQEKAMHNETCGNTAVTIPLGKITENAANKKDEKEKQCTAALHIPANEGDASKSSISDILLHHLSKEPFLRGQGIDCETL
Gene Sequence PQEKAMHNETCGNTAVTIPLGKITENAANKKDEKEKQCTAALHIPANEGDASKSSISDILLHHLSKEPFLRGQGIDCETL
Gene ID - Mouse ENSMUSG00000049565
Gene ID - Rat ENSRNOG00000028025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AKNAD1 pAb (ATL-HPA030272)
Datasheet Anti AKNAD1 pAb (ATL-HPA030272) Datasheet (External Link)
Vendor Page Anti AKNAD1 pAb (ATL-HPA030272) at Atlas Antibodies

Documents & Links for Anti AKNAD1 pAb (ATL-HPA030272)
Datasheet Anti AKNAD1 pAb (ATL-HPA030272) Datasheet (External Link)
Vendor Page Anti AKNAD1 pAb (ATL-HPA030272)