Anti AKNAD1 pAb (ATL-HPA030271)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030271-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AKNAD1
Alternative Gene Name: C1orf62, MGC26989
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049565: 49%, ENSRNOG00000028025: 51%
Entrez Gene ID: 254268
Uniprot ID: Q5T1N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEWKQNVEKKGHGRINCGRFSIVLHEKAPHSDSTPNSDTGHSFYSDSGTEMQSNKCQDCGTKIPTSRRACRKEPTKEFHY |
Gene Sequence | LEWKQNVEKKGHGRINCGRFSIVLHEKAPHSDSTPNSDTGHSFYSDSGTEMQSNKCQDCGTKIPTSRRACRKEPTKEFHY |
Gene ID - Mouse | ENSMUSG00000049565 |
Gene ID - Rat | ENSRNOG00000028025 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AKNAD1 pAb (ATL-HPA030271) | |
Datasheet | Anti AKNAD1 pAb (ATL-HPA030271) Datasheet (External Link) |
Vendor Page | Anti AKNAD1 pAb (ATL-HPA030271) at Atlas Antibodies |
Documents & Links for Anti AKNAD1 pAb (ATL-HPA030271) | |
Datasheet | Anti AKNAD1 pAb (ATL-HPA030271) Datasheet (External Link) |
Vendor Page | Anti AKNAD1 pAb (ATL-HPA030271) |