Anti AKNAD1 pAb (ATL-HPA030271)

Atlas Antibodies

SKU:
ATL-HPA030271-25
  • Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in reactions center cells and in a fraction of cells outside the reaction center.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: AKNA domain containing 1
Gene Name: AKNAD1
Alternative Gene Name: C1orf62, MGC26989
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049565: 49%, ENSRNOG00000028025: 51%
Entrez Gene ID: 254268
Uniprot ID: Q5T1N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEWKQNVEKKGHGRINCGRFSIVLHEKAPHSDSTPNSDTGHSFYSDSGTEMQSNKCQDCGTKIPTSRRACRKEPTKEFHY
Gene Sequence LEWKQNVEKKGHGRINCGRFSIVLHEKAPHSDSTPNSDTGHSFYSDSGTEMQSNKCQDCGTKIPTSRRACRKEPTKEFHY
Gene ID - Mouse ENSMUSG00000049565
Gene ID - Rat ENSRNOG00000028025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AKNAD1 pAb (ATL-HPA030271)
Datasheet Anti AKNAD1 pAb (ATL-HPA030271) Datasheet (External Link)
Vendor Page Anti AKNAD1 pAb (ATL-HPA030271) at Atlas Antibodies

Documents & Links for Anti AKNAD1 pAb (ATL-HPA030271)
Datasheet Anti AKNAD1 pAb (ATL-HPA030271) Datasheet (External Link)
Vendor Page Anti AKNAD1 pAb (ATL-HPA030271)