Anti AKIRIN1 pAb (ATL-HPA051871)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051871-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AKIRIN1
Alternative Gene Name: C1orf108, FLJ12666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023075: 88%, ENSRNOG00000026610: 89%
Entrez Gene ID: 79647
Uniprot ID: Q9H9L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFT |
Gene Sequence | RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFT |
Gene ID - Mouse | ENSMUSG00000023075 |
Gene ID - Rat | ENSRNOG00000026610 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AKIRIN1 pAb (ATL-HPA051871) | |
Datasheet | Anti AKIRIN1 pAb (ATL-HPA051871) Datasheet (External Link) |
Vendor Page | Anti AKIRIN1 pAb (ATL-HPA051871) at Atlas Antibodies |
Documents & Links for Anti AKIRIN1 pAb (ATL-HPA051871) | |
Datasheet | Anti AKIRIN1 pAb (ATL-HPA051871) Datasheet (External Link) |
Vendor Page | Anti AKIRIN1 pAb (ATL-HPA051871) |