Anti AKIP1 pAb (ATL-HPA061391)
Atlas Antibodies
- SKU:
- ATL-HPA061391-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AKIP1
Alternative Gene Name: BCA3, C11orf17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031023: 63%, ENSRNOG00000013744: 63%
Entrez Gene ID: 56672
Uniprot ID: Q9NQ31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGE |
Gene Sequence | VDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGE |
Gene ID - Mouse | ENSMUSG00000031023 |
Gene ID - Rat | ENSRNOG00000013744 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AKIP1 pAb (ATL-HPA061391) | |
Datasheet | Anti AKIP1 pAb (ATL-HPA061391) Datasheet (External Link) |
Vendor Page | Anti AKIP1 pAb (ATL-HPA061391) at Atlas Antibodies |
Documents & Links for Anti AKIP1 pAb (ATL-HPA061391) | |
Datasheet | Anti AKIP1 pAb (ATL-HPA061391) Datasheet (External Link) |
Vendor Page | Anti AKIP1 pAb (ATL-HPA061391) |