Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042485-25

• 
• 
• 

Protein Description: A kinase (PRKA) anchor protein 8-like
Gene Name: AKAP8L
Alternative Gene Name: HAP95, NAKAP95
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002625: 92%, ENSRNOG00000006355: 93%
Entrez Gene ID: 26993
Uniprot ID: Q9ULX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEEGKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTAD
• Gene Sequence: DEEGKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTAD
• Gene ID - Mouse: ENSMUSG00000002625
• Gene ID - Rat: ENSRNOG00000006355
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation) – 1 Found

Luo, Qiu-Yun; Di, Tian; Qiu, Miao-Zhen; Xia, Zeng-Fei; Du, Yong; Lin, Run-Duan; Yang, Li-Qiong; Sun, Yu-Ting; Yang, Da-Jun; Sun, Jian; Zhang, Lin. High AKAP8L expression predicts poor prognosis in esophageal squamous cell carcinoma. Cancer Cell International. 2022;22(1):90.