Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042485-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: AKAP8L
Alternative Gene Name: HAP95, NAKAP95
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002625: 92%, ENSRNOG00000006355: 93%
Entrez Gene ID: 26993
Uniprot ID: Q9ULX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DEEGKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTAD |
| Gene Sequence | DEEGKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTAD |
| Gene ID - Mouse | ENSMUSG00000002625 |
| Gene ID - Rat | ENSRNOG00000006355 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation) | |
| Datasheet | Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation) | |
| Datasheet | Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation) |
| Citations for Anti AKAP8L pAb (ATL-HPA042485 w/enhanced validation) – 1 Found |
| Luo, Qiu-Yun; Di, Tian; Qiu, Miao-Zhen; Xia, Zeng-Fei; Du, Yong; Lin, Run-Duan; Yang, Li-Qiong; Sun, Yu-Ting; Yang, Da-Jun; Sun, Jian; Zhang, Lin. High AKAP8L expression predicts poor prognosis in esophageal squamous cell carcinoma. Cancer Cell International. 2022;22(1):90. PubMed |