Anti AKAP8 pAb (ATL-HPA004776)

Atlas Antibodies

SKU:
ATL-HPA004776-25
  • Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: A kinase (PRKA) anchor protein 8
Gene Name: AKAP8
Alternative Gene Name: AKAP95, DKFZp586B1222
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024045: 53%, ENSRNOG00000006559: 58%
Entrez Gene ID: 10270
Uniprot ID: O43823
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVP
Gene Sequence PEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVP
Gene ID - Mouse ENSMUSG00000024045
Gene ID - Rat ENSRNOG00000006559
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AKAP8 pAb (ATL-HPA004776)
Datasheet Anti AKAP8 pAb (ATL-HPA004776) Datasheet (External Link)
Vendor Page Anti AKAP8 pAb (ATL-HPA004776) at Atlas Antibodies

Documents & Links for Anti AKAP8 pAb (ATL-HPA004776)
Datasheet Anti AKAP8 pAb (ATL-HPA004776) Datasheet (External Link)
Vendor Page Anti AKAP8 pAb (ATL-HPA004776)