Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028327-25

• 
• 

Protein Description: A kinase (PRKA) anchor protein 7
Gene Name: AKAP7
Alternative Gene Name: AKAP15, AKAP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039166: 61%, ENSRNOG00000013202: 62%
Entrez Gene ID: 9465
Uniprot ID: Q9P0M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK
• Gene Sequence: EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK
• Gene ID - Mouse: ENSMUSG00000039166
• Gene ID - Rat: ENSRNOG00000013202
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.