Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028327-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: A kinase (PRKA) anchor protein 7
Gene Name: AKAP7
Alternative Gene Name: AKAP15, AKAP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039166: 61%, ENSRNOG00000013202: 62%
Entrez Gene ID: 9465
Uniprot ID: Q9P0M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK
Gene Sequence EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK
Gene ID - Mouse ENSMUSG00000039166
Gene ID - Rat ENSRNOG00000013202
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation)
Datasheet Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation)
Datasheet Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation)