Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028327-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: AKAP7
Alternative Gene Name: AKAP15, AKAP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039166: 61%, ENSRNOG00000013202: 62%
Entrez Gene ID: 9465
Uniprot ID: Q9P0M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK |
| Gene Sequence | EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK |
| Gene ID - Mouse | ENSMUSG00000039166 |
| Gene ID - Rat | ENSRNOG00000013202 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) | |
| Datasheet | Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) | |
| Datasheet | Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKAP7 pAb (ATL-HPA028327 w/enhanced validation) |