Anti AKAP7 pAb (ATL-HPA027200)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027200-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AKAP7
Alternative Gene Name: AKAP15, AKAP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039166: 86%, ENSRNOG00000013202: 86%
Entrez Gene ID: 9465
Uniprot ID: Q9P0M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGD |
Gene Sequence | AKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGD |
Gene ID - Mouse | ENSMUSG00000039166 |
Gene ID - Rat | ENSRNOG00000013202 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AKAP7 pAb (ATL-HPA027200) | |
Datasheet | Anti AKAP7 pAb (ATL-HPA027200) Datasheet (External Link) |
Vendor Page | Anti AKAP7 pAb (ATL-HPA027200) at Atlas Antibodies |
Documents & Links for Anti AKAP7 pAb (ATL-HPA027200) | |
Datasheet | Anti AKAP7 pAb (ATL-HPA027200) Datasheet (External Link) |
Vendor Page | Anti AKAP7 pAb (ATL-HPA027200) |