Anti AKAP7 pAb (ATL-HPA027172)

Atlas Antibodies

SKU:
ATL-HPA027172-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and AKAP7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY429496).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: A kinase (PRKA) anchor protein 7
Gene Name: AKAP7
Alternative Gene Name: AKAP15, AKAP18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039166: 80%, ENSRNOG00000013202: 81%
Entrez Gene ID: 9465
Uniprot ID: Q9P0M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKK
Gene Sequence HVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKK
Gene ID - Mouse ENSMUSG00000039166
Gene ID - Rat ENSRNOG00000013202
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AKAP7 pAb (ATL-HPA027172)
Datasheet Anti AKAP7 pAb (ATL-HPA027172) Datasheet (External Link)
Vendor Page Anti AKAP7 pAb (ATL-HPA027172) at Atlas Antibodies

Documents & Links for Anti AKAP7 pAb (ATL-HPA027172)
Datasheet Anti AKAP7 pAb (ATL-HPA027172) Datasheet (External Link)
Vendor Page Anti AKAP7 pAb (ATL-HPA027172)