Anti AKAP4 pAb (ATL-HPA005949 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005949-25

Protein Description: A kinase (PRKA) anchor protein 4
Gene Name: AKAP4
Alternative Gene Name: AKAP82, CT99, Fsc1, hAKAP82, HI, p82
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050089: 69%, ENSRNOG00000002921: 65%
Entrez Gene ID: 8852
Uniprot ID: Q5JQC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQ
• Gene Sequence: SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQ
• Gene ID - Mouse: ENSMUSG00000050089
• Gene ID - Rat: ENSRNOG00000002921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKAP4 pAb (ATL-HPA005949 w/enhanced validation) – 1 Found

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.