Anti AKAP3 pAb (ATL-HPA039765 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039765-25

• 

Protein Description: A kinase (PRKA) anchor protein 3
Gene Name: AKAP3
Alternative Gene Name: AKAP110, CT82, FSP95, SOB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030344: 60%, ENSRNOG00000059227: 61%
Entrez Gene ID: 10566
Uniprot ID: O75969
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCERP
• Gene Sequence: AQGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCERP
• Gene ID - Mouse: ENSMUSG00000030344
• Gene ID - Rat: ENSRNOG00000059227
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.