Anti AKAP17A pAb (ATL-HPA043247 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043247-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: AKAP17A
Alternative Gene Name: 721P, CCDC133, CXYorf3, DXYS155E, MGC39904, SFRS17A, XE7, XE7Y
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059708: 41%, ENSRNOG00000009746: 41%
Entrez Gene ID: 8227
Uniprot ID: Q02040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVF |
| Gene Sequence | GEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVF |
| Gene ID - Mouse | ENSMUSG00000059708 |
| Gene ID - Rat | ENSRNOG00000009746 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKAP17A pAb (ATL-HPA043247 w/enhanced validation) | |
| Datasheet | Anti AKAP17A pAb (ATL-HPA043247 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKAP17A pAb (ATL-HPA043247 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AKAP17A pAb (ATL-HPA043247 w/enhanced validation) | |
| Datasheet | Anti AKAP17A pAb (ATL-HPA043247 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKAP17A pAb (ATL-HPA043247 w/enhanced validation) |