Anti AKAP17A pAb (ATL-HPA043247 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043247-25

• 

Protein Description: A kinase (PRKA) anchor protein 17A
Gene Name: AKAP17A
Alternative Gene Name: 721P, CCDC133, CXYorf3, DXYS155E, MGC39904, SFRS17A, XE7, XE7Y
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059708: 41%, ENSRNOG00000009746: 41%
Entrez Gene ID: 8227
Uniprot ID: Q02040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVF
• Gene Sequence: GEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVF
• Gene ID - Mouse: ENSMUSG00000059708
• Gene ID - Rat: ENSRNOG00000009746
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.